DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and TUL1

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae


Alignment Length:455 Identity:94/455 - (20%)
Similarity:152/455 - (33%) Gaps:183/455 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSLLSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILD-----ILP 77
            ||:::|    ||..|.|. ::....:|...:.:...||     |::.|    |.::.     ||.
Yeast   424 PSMVNK----ISFYCFSM-INLVDGSLATLYFVAASVV-----PELYL----PLVISAFSCFILA 474

  Fly    78 DTYQRLRLIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLFKEGKEKMFDEN---------- 132
            ..:: :|.:.|     ::....||. ||.|.||:|           |....:|||          
Yeast   475 SIFE-IRYLIS-----IYASQVNEQ-NVGIINLLR-----------GNTGTYDENRPRPAFIPDE 521

  Fly   133 -----SHYRRNLTKLSLVFSHML-------SELKAIFPNGVFAGDQFRITKADAADFWKSNFGNS 185
                 |.|.|....| ::|:.::       .:|:.:|                  ::......||
Yeast   522 GSIGGSLYGRFFFML-IIFTFLILSSTSWPRQLRMVF------------------EYILIFILNS 567

  Fly   186 TLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNWQILA 250
            ..:| :|||   |.|..|.|..|........:.:.|.....:.|.:.|       |::|:..:: 
Yeast   568 YWIP-QIFR---NAVKGIPSRRERARSSIGGNRSQNKMPLLWSFVIGT-------TIIRSLPVV- 620

  Fly   251 VTHPGYVAFLTYDEVKARLQRYILKAGSYVFR----------LSCTRLGQWAIGYVTAEGEILQT 305
                                 |:....|.|||          ||...|.|.:|.|   ..::|.:
Yeast   621 ---------------------YVFTYSSNVFRHHKDVHFVVFLSLWLLFQISILY---SQDVLGS 661

  Fly   306 ---IPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSP----TEDHITVTQEQYELYCEMG 363
               :|:                :..|||.:|...||:...|.    |.:| ||.           
Yeast   662 RWFLPK----------------HTIPDGYSYFKPLSNEYISEHGGGTAEH-TVD----------- 698

  Fly   364 STFQLCKICAENDKDIRIE----------------PCGHLLCTPCLTSWQVDSEGQGCPFCRAEI 412
                 |.||. :|..|.||                ||.|:..|.||.:|.  :....||.||:.:
Yeast   699 -----CAICM-SDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWM--NYKLQCPVCRSPL 755

  Fly   413  412
            Yeast   756  755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 29/147 (20%)
Cbl_N2 167..250 CDD:280857 16/82 (20%)
SH2_Cbl-b_TKB 244..340 CDD:198176 20/108 (19%)
zf-C3HC4_3 367..415 CDD:290631 18/62 (29%)
UBA_Cbl_like 834..873 CDD:270503
TUL1NP_012890.1 COG5540 320..758 CDD:227827 94/455 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.