DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and RNFT2

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001103373.1 Gene:RNFT2 / 84900 HGNCID:25905 Length:444 Species:Homo sapiens


Alignment Length:252 Identity:55/252 - (21%)
Similarity:94/252 - (37%) Gaps:78/252 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GNSTLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNW- 246
            ||:..|.:....|:|..        ..:.||..:::.  ||     ||:.      |:..:.:: 
Human   226 GNTLYVLYTFSSQQLYN--------SLIFLKPNLEML--DF-----FDLL------WIVGIADFV 269

  Fly   247 --------QILAVTHPGYVAFLTYDEVKARLQRY-ILKAGSYVFRLSCTRLGQWAIGYVTAE--- 299
                    :.|.|..|..:.     .||::.:.| :::..|.:|| |...:..| ..|:..:   
Human   270 LKYITIALKCLIVALPKIIL-----AVKSKGKFYLVIEELSQLFR-SLVPIQLW-YKYIMGDDSS 327

  Fly   300 -----GEILQTIPQNKSLCQAL-----LDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQE 354
                 |.:|..:   .|||::.     :.|.|:...|....|.|.              :..|.:
Human   328 NSYFLGGVLIVL---YSLCKSFDICGRVGGVRKALKLLCTSQNYG--------------VRATGQ 375

  Fly   355 QYELYC-EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRA 410
            |    | |.|   .:|.||....::..|..|.|:.|..||..| :|.| :.||.||:
Human   376 Q----CTEAG---DICAICQAEFREPLILLCQHVFCEECLCLW-LDRE-RTCPLCRS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857 12/75 (16%)
SH2_Cbl-b_TKB 244..340 CDD:198176 22/118 (19%)
zf-C3HC4_3 367..415 CDD:290631 16/44 (36%)
UBA_Cbl_like 834..873 CDD:270503
RNFT2NP_001103373.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..149
RING-HC_RNFT2 382..422 CDD:319656 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.