DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT1G55530

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001321432.1 Gene:AT1G55530 / 842000 AraportID:AT1G55530 Length:351 Species:Arabidopsis thaliana


Alignment Length:217 Identity:47/217 - (21%)
Similarity:77/217 - (35%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HPGYVAFLTYDEVKARLQRYI----LKAGSYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLC 313
            :||.|..:........:|...    :.|||         ||.:.||            |..:.|.
plant   145 NPGRVILINTSNQTITVQNSADMDSVPAGS---------LGDYFIG------------PGFEMLL 188

  Fly   314 QALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAEN--- 375
            |.|.:..       |:.....|....||::..    ||..|:         |.| |.:|.::   
plant   189 QRLAEND-------PNRYGTPPAKKEAVEALA----TVKIEE---------TLQ-CSVCLDDFEI 232

  Fly   376 DKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIKGTE---QIVVDAFDPRKQHNRNVT-- 434
            ..:.::.||.|...:.||..| ::.|   .||.||.::...|   ..|....|.....:.:.|  
plant   233 GTEAKLMPCTHKFHSDCLLPWLELHS---SCPVCRYQLPADEAKTDSVTTTSDNNGSSSASATTS 294

  Fly   435 --------NGRQQQQEEDDTED 448
                    |.||:::||::.|:
plant   295 HGAENSDGNRRQEEEEEEEEEE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 17/90 (19%)
zf-C3HC4_3 367..415 CDD:290631 14/51 (27%)
UBA_Cbl_like 834..873 CDD:270503
AT1G55530NP_001321432.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.