DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and CIP8

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_201297.1 Gene:CIP8 / 836616 AraportID:AT5G64920 Length:334 Species:Arabidopsis thaliana


Alignment Length:219 Identity:44/219 - (20%)
Similarity:67/219 - (30%) Gaps:85/219 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 RLSCTRLGQWAIGYVTAEGEILQTIPQNK---------------------SLCQALLDGHREGFY 325
            |....|:..||        |||..|..|.                     :..:|||....||  
plant   165 RTGRNRILDWA--------EILMGIEDNSIEFRMESDRYAGNPADYIDDAAGYEALLQNLAEG-- 219

  Fly   326 LYPDG------QAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKIC------AENDKD 378
               ||      :...|...||:::         .|.:|:....|....:|.:|      .|..|.
plant   220 ---DGGGGGGRRGAPPAAKSAIEA---------LETFEVSSSEGEMVMVCAVCKDGMVMGETGKK 272

  Fly   379 IRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRKQHNRNVTNGRQQQQEE 443
            :   ||||.....|:..|.  .....||.||.:::                   ..:...:::.:
plant   273 L---PCGHCYHGDCIVPWL--GTRNSCPVCRFQLE-------------------TDDAEYEEERK 313

  Fly   444 DDTEDIGDFNIATSSLHALSTSST 467
            ..|..:.|      |..|.|:|||
plant   314 KRTSTVSD------SAAASSSSST 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 17/84 (20%)
zf-C3HC4_3 367..415 CDD:290631 14/53 (26%)
UBA_Cbl_like 834..873 CDD:270503
CIP8NP_201297.1 zinc_ribbon_9 14..46 CDD:405118
RING_Ubox 257..298 CDD:418438 12/45 (27%)
RING-H2 finger (C3H2C3-type) 257..297 CDD:319361 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.