DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and ATCRT1

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_200445.1 Gene:ATCRT1 / 835734 AraportID:AT5G56340 Length:396 Species:Arabidopsis thaliana


Alignment Length:249 Identity:56/249 - (22%)
Similarity:80/249 - (32%) Gaps:80/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 SCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQS-PTED 347
            |.|.||.:.||            |....|.|.|.:..       |:.|...|....||:: ||..
plant   207 SLTSLGDYFIG------------PGLDLLLQHLAEND-------PNRQGTPPARKEAVEALPTVK 252

  Fly   348 HITVTQEQYELYCEMGSTFQLCKICA---ENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFC 408
            .:...|               |.:|.   |...:.:..||.|.....|:..| ::.|   .||.|
plant   253 IMEPLQ---------------CSVCLDDFEKGTEAKEMPCKHKFHVRCIVPWLELHS---SCPVC 299

  Fly   409 RAEIKGTEQIVVDAFDPRKQHNRNVTNGRQQQQEEDD--TEDIGDFNIATSSLHALSTSSTVAAE 471
            |.|:..:    .|..|..|..:..|...|..::..:.  .|::|:                 |..
plant   300 RFELPSS----ADDDDETKTDSERVLRTRNVRETSNGNVVENVGN-----------------ADR 343

  Fly   472 KHSPHTSPRLGRRSTTPSLMAVQNDLYAGGTPTLSLPSSSCSSIAAASTSSSSS 525
            ..........|||.:.|             .|...|.|||.||  ::|||.|.|
plant   344 GREDEVRSGNGRRFSFP-------------WPFSGLFSSSSSS--SSSTSGSQS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 13/55 (24%)
zf-C3HC4_3 367..415 CDD:290631 14/51 (27%)
UBA_Cbl_like 834..873 CDD:270503
ATCRT1NP_200445.1 zinc_ribbon_9 8..39 CDD:405118
RING-H2_RNF181 258..303 CDD:319583 14/62 (23%)
HRD1 <259..359 CDD:227568 25/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.