DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT5G43530

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_199166.1 Gene:AT5G43530 / 834373 AraportID:AT5G43530 Length:1277 Species:Arabidopsis thaliana


Alignment Length:479 Identity:101/479 - (21%)
Similarity:170/479 - (35%) Gaps:139/479 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FPSLLSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPDTYQ 81
            ||:......|.|         ..|...|.||  :|...:.|.:..:.|.:|....:.|:..|   
plant   673 FPTATQMARGGI---------LADAMGLGKT--VMTIALILARPGRGNPENEDVLVADVNAD--- 723

  Fly    82 RLRLIYSKNEDQMHLLHANEHFNVFINNLMRK------CKQAIKLFKEGKEKMFDENSHYRRNLT 140
                  .:|..::|:.         :..:..|      |..|  |..:.|:::   .:|.:.:..
plant   724 ------KRNRKEIHMA---------LTTVKAKGGTLIICPMA--LLSQWKDEL---ETHSKPDTV 768

  Fly   141 KLSLVF----SHMLSELKAIFPNGVFAGDQFRITKADAADFWKSNFGNSTL--VPWKIFRQELNK 199
            .:.:.:    :|   :.|||..:.|.......:|.|     :|.:..||..  :.|  :|..|::
plant   769 SVLVYYGGDRTH---DAKAIASHDVVLTTYGVLTSA-----YKQDMANSIFHRIDW--YRIVLDE 823

  Fly   200 VHPIISGLEAMALKTTIDLTCN-------DFISNFEFDVFTRL----FQPWVTLLRNWQILAVTH 253
            .|.|.| .:..|.|.|.:|:.:       ..:.|...|:::.|    .:||....  |....:..
plant   824 AHTIKS-WKTQAAKATFELSSHCRWCLTGTPLQNKLEDLYSLLCFLHVEPWCNWA--WWSKLIQK 885

  Fly   254 PGYVAFLTYDE--------VKARLQRYIL--------KAGSYVFRLSCT---------------- 286
            |       |:.        :||.|:..:|        |.||.:..|..|                
plant   886 P-------YENGDPRGLKLIKAILRPLMLRRTKETRDKEGSLILELPPTDVQVIECEQSEAERDF 943

  Fly   287 -----RLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLY--PDGQAY----------- 333
                 :..:.......|:|::|........|...|.......|.:.  .|.|.|           
plant   944 YTALFKRSKVQFDQFVAQGKVLHNYANILELLLRLRQCCNHPFLVMSRADSQQYADLDSLARRFL 1008

  Fly   334 --NPDLSSAVQSPTEDHI-TVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPC-LT 394
              ||| |.:..:|:..:| .|.|:..:     |::.: |.||.|:..|..:.||.|.:|..| ||
plant  1009 DNNPD-SVSQNAPSRAYIEEVIQDLRD-----GNSKE-CPICLESADDPVLTPCAHRMCRECLLT 1066

  Fly   395 SWQVDSEGQGCPFCRAEIKGTEQI 418
            ||:..|.|. ||.||..:|.||.|
plant  1067 SWRSPSCGL-CPICRTILKRTELI 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 22/130 (17%)
Cbl_N2 167..250 CDD:280857 21/95 (22%)
SH2_Cbl-b_TKB 244..340 CDD:198176 25/147 (17%)
zf-C3HC4_3 367..415 CDD:290631 21/48 (44%)
UBA_Cbl_like 834..873 CDD:270503
AT5G43530NP_199166.1 HIRAN 402..490 CDD:214906
SNF2_N 680..988 CDD:278600 63/361 (17%)
DEXDc 681..853 CDD:238005 40/216 (19%)
RING 1039..1083 CDD:238093 20/45 (44%)
Helicase_C 1112..1224 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.