DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AIP2

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_197591.1 Gene:AIP2 / 832215 AraportID:AT5G20910 Length:310 Species:Arabidopsis thaliana


Alignment Length:161 Identity:44/161 - (27%)
Similarity:65/161 - (40%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 IGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPD-----GQAYNPDLSSAVQSPTEDHITVT 352
            :|..::.|....||.:..:|.|.|::|..   .:.||     |....|..|..|    .:.:.|.
plant   157 VGGESSNGPTENTIGETANLMQELINGLD---MIIPDILDDGGPPRAPPASKEV----VEKLPVI 214

  Fly   353 QEQYELYCEMGSTFQLCKICAEN----DKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIK 413
            ....||..:.|:..:.| ||.||    || ::..||.|....|||..|.  .|...||.||.|: 
plant   215 IFTEELLKKFGAEAECC-ICKENLVIGDK-MQELPCKHTFHPPCLKPWL--DEHNSCPICRHEL- 274

  Fly   414 GTEQIVVDAFDPRKQHNRNVTNGRQQQQEED 444
                    ..|.:|..|   ...|:::.||:
plant   275 --------PTDDQKYEN---WKEREKEAEEE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 13/51 (25%)
zf-C3HC4_3 367..415 CDD:290631 20/51 (39%)
UBA_Cbl_like 834..873 CDD:270503
AIP2NP_197591.1 RING_Ubox 229..271 CDD:418438 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.