powered by:
Protein Alignment Cbl and AT5G01960
DIOPT Version :9
Sequence 1: | NP_648224.1 |
Gene: | Cbl / 38961 |
FlyBaseID: | FBgn0020224 |
Length: | 878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_568096.1 |
Gene: | AT5G01960 / 831906 |
AraportID: | AT5G01960 |
Length: | 426 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 27/53 - (50%) |
Gaps: | 2/53 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 361 EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIK 413
::.:...||.||.|......:..|.|:.|..|::.| .:.| :.||.|||.:|
plant 357 QVNAAGDLCAICQEKMHTPILLRCKHMFCEDCVSEW-FERE-RTCPLCRALVK 407
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.