DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT3G58030

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001190122.1 Gene:AT3G58030 / 824972 AraportID:AT3G58030 Length:436 Species:Arabidopsis thaliana


Alignment Length:335 Identity:67/335 - (20%)
Similarity:116/335 - (34%) Gaps:128/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 GSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIV-------- 419
            |:.|. |.||.:..|:..:..||||.|.|||..|...|:.:.||.|:.|:  |.:.|        
plant   134 GNFFD-CNICLDLSKEPVLTCCGHLYCWPCLYQWLQISDAKECPVCKGEV--TSKTVTPIYGRGN 195

  Fly   420 --------VDAFDPRKQHNRNVTNGRQ------------------QQQEEDDTEDIGDFNIATSS 458
                    :|...|.:.|.|.:.:.|.                  |.:.:.|:..:.||      
plant   196 HKREIEESLDTKVPMRPHARRIESLRNTIQRSPFTIPMEEMIRRIQNRFDRDSTPVPDF------ 254

  Fly   459 LHALSTSSTVAAEKHSPHTSPRLGRRSTTPSLMAVQNDLYAGGTPTLSLPSSSCSSIAAASTS-- 521
                  |:..|:|:.:...:..|.|..|:..:.:.||.           .|::.::|.|||..  
plant   255 ------SNREASERVNDRANSILNRLMTSRGVRSEQNQ-----------ASAAAAAIVAASEDID 302

  Fly   522 --------------------------SSSSLASVATVAASTSSSQ---------------HQQPQ 545
                                      .|..:|.::|..::.||::               ||:..
plant   303 LNPNIAPDLEGESNTRFHPLLIRRQLQSHRVARISTFTSALSSAERLVDAYFRTHPLGRNHQEQN 367

  Fly   546 PSAP----------PASAVLSNGGGGGGGGGASSSQKNTNRMSAPLIGSCVANSTYGQKLPQNCS 600
            ..||          ..:||::           |.||.:|    |..|.|...:::..::..:|.|
plant   368 HHAPVVVDDRDSFSSIAAVIN-----------SESQVDT----AVEIDSMALSTSSSRRRNENGS 417

  Fly   601 HSSTSSSSDN 610
            ..|...|:|:
plant   418 RVSDVDSADS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 18/47 (38%)
UBA_Cbl_like 834..873 CDD:270503
AT3G58030NP_001190122.1 PLN03208 134..>226 CDD:178747 27/94 (29%)
RING-HC_AtRMA_like 137..180 CDD:319659 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.