DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and ATL6

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_566249.1 Gene:ATL6 / 819684 AraportID:AT3G05200 Length:398 Species:Arabidopsis thaliana


Alignment Length:295 Identity:64/295 - (21%)
Similarity:94/295 - (31%) Gaps:92/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 CKICA---ENDKDIRIEP-CGHLLCTPCLTSWQVDSEGQGCPFCRAEIK------------GT-- 415
            |.||.   |:|:.:|:.| |.|:....|:.:|.  .....||.|||.:.            ||  
plant   128 CAICLNEFEDDETLRLLPKCDHVFHPHCIDAWL--EAHVTCPVCRANLAEQVAEGESVEPGGTEP 190

  Fly   416 --------------------EQIVVDAFDPRK-----------QHNRNVTNGRQQQQEEDDT--- 446
                                ||:|....|.|:           :.:|:.|.|....|..:.|   
plant   191 DLELQQVVVNPEPVVTAPVPEQLVTSEVDSRRLPGVPVDLKRVKFSRSHTTGHSVVQPGECTERF 255

  Fly   447 -----EDI-----GDFNI-ATSSLHALSTSSTVAAEKHSPHTSPRLGR---RSTTPSLMAVQNDL 497
                 ||:     .|:.: .|:||..|....:....|....:..|..|   |.|...|...::| 
plant   256 TLRLPEDVRKRIMKDWKLNRTNSLLVLPRGGSSRRGKPIDRSRARSDRWLFRKTPSFLWRSRDD- 319

  Fly   498 YAGGTPTLSLPSSSCSSIAAASTSSSSSLASVATVAASTSSSQHQQPQPSAPPASAVLSNGGGGG 562
               |:..|....|..:|....||.|.|..|.........:|...:......|         .||.
plant   320 ---GSIRLGATGSVRASAVPNSTGSDSVRAGDRWAFLRNASFLWRNSSVHVP---------RGGV 372

  Fly   563 GGGGASSSQKNTNRMSAPLIGSCVANSTYGQ-KLP 596
            ...|..:|.|:|.          .:.||.|. :||
plant   373 NKDGEGTSVKSTG----------ASGSTSGSVRLP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 16/61 (26%)
UBA_Cbl_like 834..873 CDD:270503
ATL6NP_566249.1 HRD1 <113..>219 CDD:227568 21/92 (23%)
RING-H2_EL5_like 127..170 CDD:319375 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.