DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT2G44410

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_181969.2 Gene:AT2G44410 / 819048 AraportID:AT2G44410 Length:413 Species:Arabidopsis thaliana


Alignment Length:279 Identity:58/279 - (20%)
Similarity:95/279 - (34%) Gaps:79/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 CKICAENDKDIRIEPCGHLLCTPCLTSWQ---VDSEGQGCPFCRAEIKGTEQIVV----DAFD-- 424
            |.||.|..:|..:..||||.|..|.  :|   :....:.||.|..|:...|.|.:    |..|  
plant   125 CNICLEKAEDPILTCCGHLFCWGCF--YQLPLIYLNIKECPVCDGEVTDAEVIPIYGNGDDCDGT 187

  Fly   425 -----------PRKQHNRNVTNGRQQ----------QQEEDDTEDI--------------GD-FN 453
                       |.:.:.:.|.:.||:          ..|.:..|.|              || |.
plant   188 KPKLEDCGISLPPRPNAKRVESVRQKIINRGNPFFPGHENEAIEHIRRTIDSIGLQALAQGDEFG 252

  Fly   454 IATSSLHALSTSSTVAAEKHSPHTSPRLG------RRSTTPSLMAVQNDLYA----------GGT 502
            :.....:..........::|..|..|..|      ..:|.|.|:...:|:.|          ...
plant   253 LTNIINNGGDNGGQQQQQQHHHHHHPPFGPLRLLPPYATFPGLLVDTSDIPAPFDDDAFDVDSFV 317

  Fly   503 PTLSL------PSSSCSSIAAASTSSSSSLASVATVAASTSSSQHQQPQPSAPPASAVLSNGGGG 561
            .|.||      ||.:..:....:.|:::|    .|::....||....|:..|.|:|::::.....
plant   318 DTTSLRRNRRRPSPAVRASYQRNRSNNAS----QTISFRLGSSASSAPREFAVPSSSIMTRSQTV 378

  Fly   562 G------GGGGASSSQKNT 574
            .      ....||||::.|
plant   379 NPTEVVTSSTSASSSRRRT 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 16/48 (33%)
UBA_Cbl_like 834..873 CDD:270503
AT2G44410NP_181969.2 PEX10 <71..175 CDD:227861 17/51 (33%)
RING_Ubox 123..165 CDD:418438 14/41 (34%)
RING-HC finger (C3HC4-type) 125..165 CDD:319361 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.