DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and AT2G42350

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_181764.1	Gene:	AT2G42350 / 818836	AraportID:	AT2G42350	Length:	217	Species:	Arabidopsis thaliana

Alignment Length:	47	Identity:	13/47 - (27%)
Similarity:	18/47 - (38%)	Gaps:	6/47 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   369 CKIC----AENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAE 411
            |.:|    .|.|....:..|.|:....|:.:|....  ..||.||.|
plant   100 CAVCLSLLEEKDNARMLPNCKHVFHVSCVDTWLTTQ--STCPVCRTE 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176
		zf-C3HC4_3	367..415	CDD:290631	13/47 (28%)
		UBA_Cbl_like	834..873	CDD:270503
AT2G42350	NP_181764.1	zf-RING_2	99..142	CDD:290367	10/43 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910