DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT2G35420

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana


Alignment Length:273 Identity:59/273 - (21%)
Similarity:90/273 - (32%) Gaps:83/273 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VFTRLFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAGSYVFRLSCTRLGQWAIGY 295
            ||..:..| ||::....:|.|...|:.:..        |.:::|.      ||..|    |.: .
plant    15 VFPSVSMP-VTVVLTGVLLFVIFAGFFSLF--------LWQFLLN------RLFTT----WNL-Q 59

  Fly   296 VTAEGEILQ--TIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYEL 358
            .|..|:::.  |.|:|..|...::.......|            |||.:   ::|.|.       
plant    60 RTPYGDLIHVATPPENTGLDPFIIRSFPVFHY------------SSATK---KNHGTE------- 102

  Fly   359 YCEMGSTFQLCKICAE--NDKD-IR-IEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIV 419
                      |.||..  :|:| :| |..|.|...:.|:..|  ....:.||.||.|:       
plant   103 ----------CAICLSEFSDEDTVRLITVCRHPFHSNCIDLW--FELHKTCPVCRCEL------- 148

  Fly   420 VDAFDPRKQHNRNVTNGRQQQQEEDDTEDIGDFNIATSSLHALSTSSTVAAEKHSPHTSP-RLGR 483
                ||..     :.:||.:......|..|.|.|      |......|..:.|.....|. |..|
plant   149 ----DPGM-----IGSGRLESFHNTVTITIQDIN------HDEENPPTAGSSKRLIEASAWRFSR 198

  Fly   484 RSTTPSLMAVQND 496
            ..:|...|....|
plant   199 SHSTGHFMVKTTD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857 5/18 (28%)
SH2_Cbl-b_TKB 244..340 CDD:198176 17/97 (18%)
zf-C3HC4_3 367..415 CDD:290631 16/51 (31%)
UBA_Cbl_like 834..873 CDD:270503
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 13/61 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.