DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AT2G34990

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001323608.1 Gene:AT2G34990 / 818063 AraportID:AT2G34990 Length:324 Species:Arabidopsis thaliana


Alignment Length:252 Identity:51/252 - (20%)
Similarity:86/252 - (34%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QAYNPDLSSAVQSPTE-------DHITVTQEQYELYCE-----MGSTFQLCKICA---ENDKDIR 380
            ::.||...|.|:|.|.       |...:......||.|     :|.....|.:|.   |:.:.:|
plant    68 ESINPFTDSDVESRTSITAVRGLDEAIINSFPTFLYSEVKERRIGIGGVECAVCICEFEDHETLR 132

  Fly   381 IEP-CGHLLCTPCLTSWQVDSEGQGCPFCRAEI---------KGTEQIVVDA-----FDPRKQHN 430
            :.| |.|:....|::.|.  |:...||.||.::         ...|..:|::     ||.....|
plant   133 LMPECCHVFHADCVSVWL--SDHSTCPLCRVDLCLQPGERSYLNPEPDLVESTNSHLFDGVTWTN 195

  Fly   431 RN-----------------VTNGRQQQQEEDDTEDIGDFNIAT----SSLHALSTSSTVAAEKHS 474
            ||                 :...|.........:.:.:.:..|    ..:....|..||.....|
plant   196 RNRPSRSWSTRLSQCRVSQILISRSHSTGHSVVQPLDNLDRFTLRLPEEVRRQLTKKTVDNVAFS 260

  Fly   475 PHTSPRLGRRSTTP----SLMAVQNDLYAGGTPTLSLPSSSCSSIAAASTSSSSSLA 527
            ...|.|.|.||.:.    |:.:.|..:::......   |:||...|.|.:..|..::
plant   261 QARSSRRGYRSRSAGSERSVFSYQRRMHSFSDCAW---STSCGGEAVAPSKDSRRIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 2/8 (25%)
zf-C3HC4_3 367..415 CDD:290631 14/60 (23%)
UBA_Cbl_like 834..873 CDD:270503
AT2G34990NP_001323608.1 RING-H2_PA-TM-RING 117..160 CDD:319368 12/44 (27%)
RING-H2 finger (C3H2C3-type) 118..159 CDD:319368 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.