DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and COP1

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_180854.1 Gene:COP1 / 817857 AraportID:AT2G32950 Length:675 Species:Arabidopsis thaliana


Alignment Length:262 Identity:52/262 - (19%)
Similarity:77/262 - (29%) Gaps:97/262 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LCKICAENDKDIRIEPCGHLLCTPC-LTSWQVDSEGQGCPFCRAEI----------------KGT 415
            ||.||.:..||..:..|||..|..| :|..:..|:   ||.|...:                |.:
plant    51 LCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSD---CPCCSQHLTNNQLYPNFLLDKLLKKTS 112

  Fly   416 EQIVVDAFDPRKQHNRNVTNG-----------------RQQQQEEDDTEDIGDFNIATSSLHALS 463
            .:.|.....|..|....:..|                 |:::.|:::.|  .:..|....||.|.
plant   113 ARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAE--RNMQILLDFLHCLR 175

  Fly   464 TSST-----------------VAAEKHS---------------------------PHTSPRLGRR 484
            ....                 .|.|:|.                           ||...::|..
plant   176 KQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFN 240

  Fly   485 STTPSLMA------VQNDLYAGGTPTLS--LPSSSCSSIAAASTSSSSSLASVATVAASTSSSQH 541
            |.:.|:..      .||....|.....|  ||...     |.|.|.|.|| :.:||:.:.....|
plant   241 SNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKD-----ALSGSDSQSL-NQSTVSMARKKRIH 299

  Fly   542 QQ 543
            .|
plant   300 AQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 17/63 (27%)
UBA_Cbl_like 834..873 CDD:270503
COP1NP_180854.1 RING-HC_COP1 48..93 CDD:319418 16/44 (36%)
PLN00181 <148..671 CDD:177776 31/162 (19%)
WD40 repeat 375..418 CDD:293791
WD40 repeat 423..460 CDD:293791
WD40 repeat 467..503 CDD:293791
WD40 repeat 508..546 CDD:293791
WD40 repeat 552..587 CDD:293791
WD40 repeat 594..617 CDD:293791
WD40 repeat 647..670 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.