DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and Cblc

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_075713.3 Gene:Cblc / 80794 MGIID:1931457 Length:496 Species:Mus musculus


Alignment Length:417 Identity:199/417 - (47%)
Similarity:266/417 - (63%) Gaps:12/417 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DKKTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPDTYQRL----RLIYSKNEDQMHLLHAN 100
            :.:.|.:..||:.::.:.|:.|:|  ...||.:.|:||.|.|.|    :......||......|:
Mouse    14 EPRALSRAVKLLQRLEEQCRDPRM--VTGPPSLRDLLPRTAQLLGEVAKARREAREDPEGPGGAD 76

  Fly   101 EHFNVFINNLMRKCKQAIKLF-----KEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNG 160
            :...:::.||..|.:|..:|.     |:..:.:|.|.|.:||.|.||:|:||||.:||.|:||.|
Mouse    77 DFLAIYLANLEVKGRQVAELLPPRGKKDVNQDVFREGSRFRRQLAKLALIFSHMHAELSALFPAG 141

  Fly   161 VFAGDQFRITKADAADFWKSNFGNSTLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFIS 225
            .:.|..:::||..|..||:.|.|...::||..|:..|...||:..|....||::|:|||||..:|
Mouse   142 KYCGHLYQLTKGSAHIFWRQNCGVRCVLPWAEFQSLLCACHPVEPGPTMQALRSTLDLTCNGHVS 206

  Fly   226 NFEFDVFTRLFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAGSYVFRLSCTRLGQ 290
            .|||||||||||||.|||||||:|||.||||:||||||||:.|||.|..|.|||:||.|||||||
Mouse   207 VFEFDVFTRLFQPWPTLLRNWQLLAVNHPGYMAFLTYDEVQTRLQAYRDKPGSYIFRPSCTRLGQ 271

  Fly   291 WAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQ 355
            ||||||:::|.||||||.||.|.|.||.|.::|.:|:|||:.:||||:...:......|.|::||
Mouse   272 WAIGYVSSDGSILQTIPLNKPLLQVLLKGQKDGIFLFPDGKKHNPDLTELCRVEPYQRIQVSEEQ 336

  Fly   356 YELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVV 420
            ..||..|.|||||||||||.|||:||||||||||:.||.:|| ||:.|.|||||.||||.|.:.:
Mouse   337 LLLYQAMNSTFQLCKICAERDKDVRIEPCGHLLCSCCLAAWQ-DSDSQTCPFCRCEIKGREAVSI 400

  Fly   421 DAFDPRKQHNRNVTNGRQQQQEEDDTE 447
            .....|....|...:|.:....::..|
Mouse   401 CQAQERPTEVRTAADGSRDNCHQEAAE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 42/129 (33%)
Cbl_N2 167..250 CDD:280857 43/82 (52%)
SH2_Cbl-b_TKB 244..340 CDD:198176 65/95 (68%)
zf-C3HC4_3 367..415 CDD:290631 36/47 (77%)
UBA_Cbl_like 834..873 CDD:270503
CblcNP_075713.3 4H 7..144 42/131 (32%)
Cbl_N 16..144 CDD:280432 42/129 (33%)
EF-hand-like 145..217 32/71 (45%)
Cbl_N2 148..231 CDD:280857 43/82 (52%)
SH2-like 218..320 71/101 (70%)
SH2_Cbl-b_TKB 225..321 CDD:198176 65/95 (68%)
Linker. /evidence=ECO:0000250 321..349 10/27 (37%)
Interaction with RET. /evidence=ECO:0000250 350..494 40/79 (51%)
RING 350..392 CDD:238093 31/42 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 432..453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001974
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23007
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.