DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and RNF113A

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_008909.1	Gene:	RNF113A / 7737	HGNCID:	12974	Length:	343	Species:	Homo sapiens

Alignment Length:	129	Identity:	28/129 - (21%)
Similarity:	42/129 - (32%)	Gaps:	23/129 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   327 YPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTP 391
            |..|.....:|........||      |.||:..:.......|.||.::.::..:..|.|..|..
Human   226 YKHGWQIERELDEGRYGVYED------ENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCES 284

  Fly   392 C-LTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRK------QHNRNVTNGRQQQQEEDDTED 448
            | |..::....   |..|..:..|       .|:|.|      :.:|....|......||..||
Human   285 CALQHFRTTPR---CYVCDQQTNG-------VFNPAKELIAKLEKHRATGEGGASDLPEDPDED 338

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176	3/12 (25%)
		zf-C3HC4_3	367..415	CDD:290631	10/48 (21%)
		UBA_Cbl_like	834..873	CDD:270503
RNF113A	NP_008909.1	Important for interaction with SNRNP200/BRR2. /evidence=ECO:0000269\|PubMed:29144457	2..60
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	22..96
		COG5152	30..322	CDD:227481	22/111 (20%)
		Important for interaction with CXCR4. /evidence=ECO:0000269\|PubMed:28978524	50..61
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	322..343		5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910