DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and topors

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_002940310.1 Gene:topors / 734040 XenbaseID:XB-GENE-994244 Length:1018 Species:Xenopus tropicalis


Alignment Length:347 Identity:71/347 - (20%)
Similarity:112/347 - (32%) Gaps:93/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 DPRKQHNRNVTNGRQQQQEEDDTEDIGDFNIATSSLHALSTSSTVAAEKHSPH---TSPRLGRRS 485
            |.||:  |.....:|.::|...:.......:.||......:.......|:..|   ...|.|...
 Frog   706 DTRKE--RGYIASKQYRRERYRSRSRSSSQMNTSGTEHTRSDKPSGKRKYKTHHLEKQEREGNNR 768

  Fly   486 TTPSLMAVQNDLYAG----GTPTLSLP-----SSSCSSIAAASTSSSSSLASVATVAASTSSSQH 541
            ..||....:..|.||    |..|.||.     |||.........:.|.|:..|....|...:..|
 Frog   769 EVPSAKEKEGGLQAGKTSLGNHTGSLKNDLMGSSSEPKQKLRKKARSPSVEIVYEGKAVEGAKHH 833

  Fly   542 QQPQ------------PSAPPASAVLSNGGGGGGGGGASSSQKNTNRMSAPLIGSCVANSTYGQK 594
            ::.:            .::|.||.::.          ...|..:|     |::.....|. :...
 Frog   834 KKKKKKKHKKKRRREHTNSPAASPIII----------TIDSDSDT-----PMVEDLPCND-HSSL 882

  Fly   595 LPQNCS--------HS---------------------STSSSSDNASSS----SSYAILQNLH-- 624
            :|:|.:        ||                     |.|.:||..||:    ::..||..||  
 Frog   883 VPENKTSIDSTNFMHSQSPPTSTTVSTTEVLSGERADSDSKASDLCSSNRHLDAATGILDGLHFD 947

  Fly   625 DTGTPATAAAVVAPPLPPRKSSPGVETPSKATAPPPPSSSKSIDNIQCSLDNVPPQTTAPPIPPH 689
            |:........|.:||..|....  ||         |.::..|:......||||||.:|:     .
 Frog   948 DSSDEQNLLPVQSPPNIPDLCE--VE---------PLAAESSLPESDPILDNVPPTSTS-----E 996

  Fly   690 VSPSVDTLAEDLMRQQLIATST 711
            :|....:.||.:....|:...|
 Frog   997 ISELHKSFAESIFDFDLLNNVT 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631
UBA_Cbl_like 834..873 CDD:270503
toporsXP_002940310.1 RING-HC_Topors 59..98 CDD:319488
RING-HC finger (C3HC4-type) 59..97 CDD:319488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.