DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and COP1

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_016857548.1 Gene:COP1 / 64326 HGNCID:17440 Length:775 Species:Homo sapiens


Alignment Length:313 Identity:65/313 - (20%)
Similarity:108/313 - (34%) Gaps:107/313 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFD-------- 424
            :|.||.:..::..:..|||..|..|:  .|...:...||.|        ..|||..|        
Human   135 VCPICFDMIEEAYMTKCGHSFCYKCI--HQSLEDNNRCPKC--------NYVVDNIDHLYPNFLV 189

  Fly   425 -----PRKQ----------HNRNVTNGRQQQQEED------DTEDIGDFNIATSSLHALSTSSTV 468
                 .:||          |:.:.|||.:.|..:|      |..|:.:.|:....|  :.....:
Human   190 NELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELL--VQKKKQL 252

  Fly   469 AAEKHSPHTS-----PRLGRRSTTPSLMAVQNDL------------YAGGTPTLSLPSSSCSSI- 515
            .||.|:....     .::.||:....|..:|.:|            .:|    |..|.|..|:: 
Human   253 EAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSG----LYSPVSEDSTVP 313

  Fly   516 --AAASTSSSSSLAS-----------VATVAASTSSSQHQQPQPSAPPASAVLSNGGGGGGGGGA 567
              .|.|.|.|...:|           :.::..||..||        ||            |..|:
Human   314 QFEAPSPSHSLEFSSDMHRIFVNGILIISIIDSTEYSQ--------PP------------GFSGS 358

  Fly   568 SSSQKNTNRMSAPLIGSCVAN-----STYGQKLPQNCSHSSTSSSSDNASSSS 615
            |.::|.      |...|.:|:     :.:.:.|.|....:..|..||::.::|
Human   359 SQTKKQ------PWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTAS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 12/46 (26%)
UBA_Cbl_like 834..873 CDD:270503
COP1XP_016857548.1 RING-HC_COP1 132..177 CDD:319418 12/51 (24%)
PLN00181 <240..725 CDD:177776 38/198 (19%)
WD40 repeat 491..528 CDD:293791
WD40 repeat 535..571 CDD:293791
WD40 repeat 576..614 CDD:293791
WD40 repeat 620..659 CDD:293791
WD40 repeat 663..685 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.