DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and RNF213

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_005257602.2 Gene:RNF213 / 57674 HGNCID:14539 Length:5256 Species:Homo sapiens


Alignment Length:519 Identity:107/519 - (20%)
Similarity:175/519 - (33%) Gaps:147/519 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPDTYQRLRLIY 87
            |:...:.|..|..:..||.:.|.|      |.|.:.||..:.     .|:..:..:..|.|...|
Human  3763 KIKDYLEELWVQAQYITDAEGLPK------KFVDIFQQTPLG-----RFLAQLHGEPQQELLQCY 3816

  Fly    88 SKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLFKEGKEKMFDENSHYRRNLTKLSLVFSHMLSE 152
            .|:...:.:..:.|....|:...:..|.:.:|...|..|:             ::||.:.|:   
Human  3817 LKDFILLTMRVSTEEELKFLQMALWSCTRKLKAASEAPEE-------------EVSLPWVHL--- 3865

  Fly   153 LKAIFPNGVFAGDQFRITKADAADFWKSNFGNSTLVPWKIFRQELNKV------HPIISGLEAMA 211
                      |..:||           |...|.:.: ..|:.|.|:.:      |. ::|.| |.
Human  3866 ----------AYQRFR-----------SRLQNFSRI-LTIYPQVLHSLMEARWNHE-LAGCE-MT 3906

  Fly   212 LKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNWQ-----ILAVTH---PGYVAFLTYDEVKAR 268
            |.....:.|.:.::.   :......|.|:.|::|..     |.:..|   .|.:|.....||:| 
Human  3907 LDAFAAMACTEMLTR---NTLKPSPQAWLQLVKNLSMPLELICSDEHMQGSGSLAQAVIREVRA- 3967

  Fly   269 LQRYILKAGSYVFRLSCTRLGQWAIGYVTA---EGEILQT---IPQNKSLCQALLDGHREGFYLY 327
                                 ||:..:.||   |..:|.|   :|:    .|.|:..|   .:|.
Human  3968 ---------------------QWSRIFSTALFVEHVLLGTESRVPE----LQGLVTEH---VFLL 4004

  Fly   328 PDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTF--QLCKICAENDKDIRIEPCGHLLCT 390
            ......|.|:.:  ..|.|..:....|..|...:..|.|  |.|.||..:.||....||.|:.|.
Human  4005 DKCLRENSDVKT--HGPFEAVMRTLCECKETASKTLSRFGIQPCSICLGDAKDPVCLPCDHVHCL 4067

  Fly   391 PCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDP--RKQHNRNVTNGRQQQQ------------ 441
            .||.:| ..||...||:|...:.       |.|.|  .:.|...:....:.:|            
Human  4068 RCLRAW-FASEQMICPYCLTALP-------DEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVST 4124

  Fly   442 ---------EEDDTEDIGDFNIATSSLHALSTSSTVAAEKHSPHT---SPRLGRRSTTPSLMAV 493
                     |::..|.:      .|.|.........||::|..||   ||.......||.:.:|
Human  4125 ICFKDNAPPEKEVIESL------LSLLFVQKGRLRDAAQRHCEHTKSLSPFNDVVDKTPVIRSV 4182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 20/120 (17%)
Cbl_N2 167..250 CDD:280857 18/93 (19%)
SH2_Cbl-b_TKB 244..340 CDD:198176 22/109 (20%)
zf-C3HC4_3 367..415 CDD:290631 18/47 (38%)
UBA_Cbl_like 834..873 CDD:270503
RNF213XP_005257602.2 AAA 2462..2575 CDD:214640
AAA 2464..2575 CDD:99707
RING 4046..4084 CDD:238093 16/38 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.