DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and TRIM39

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_067076.2	Gene:	TRIM39 / 56658	HGNCID:	10065	Length:	518	Species:	Homo sapiens

Alignment Length:	96	Identity:	28/96 - (29%)
Similarity:	38/96 - (39%)	Gaps:	10/96 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   369 CKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQ-GCPFCRAEIKGTEQIVVDAFDPRKQHNRN 432
            |.:|.|..|:..|..|||..|..|:|.|..|.|.. .||.||...:      ..:..|.:|....
Human    29 CSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCRKTSR------YRSLRPNRQLGSM 87

  Fly   433 VTNGRQQQQEEDDTEDIGDFNIATSSLHALS 463
            |...:|.|..:   ..|.|.::......|||
Human    88 VEIAKQLQAVK---RKIRDESLCPQHHEALS 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176
		zf-C3HC4_3	367..415	CDD:290631	18/46 (39%)
		UBA_Cbl_like	834..873	CDD:270503
TRIM39	NP_067076.2	RAD18	20..>179	CDD:333230	28/96 (29%)
		RING-HC_TRIM39_C-IV	26..69	CDD:319515	16/39 (41%)
		RING-HC finger (C3HC4-type)	29..69	CDD:319515	16/39 (41%)
		AtpF	175..352	CDD:333342
		Interaction with CDKN1A. /evidence=ECO:0000269\|PubMed:23213251	268..337
		SPRY_PRY_TRIM39	335..513	CDD:293979
		Interaction with CDKN1A. /evidence=ECO:0000269\|PubMed:23213251	389..518
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910