DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and chfr

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001093485.1 Gene:chfr / 564271 ZFINID:ZDB-GENE-030131-3522 Length:637 Species:Danio rerio


Alignment Length:296 Identity:69/296 - (23%)
Similarity:97/296 - (32%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 GYVTAEGEILQTIPQNKSLCQALLDGHRE---------------GF-YLYPDGQAYNPDLSSAVQ 342
            |..|:.|...||  :.|..|..  ||..|               || ..:.|..|..|...::.:
Zfish   200 GDSTSSGSPAQT--RLKWTCWT--DGEPEEEMQRKRRKTDRDDPGFGSAHSDASADIPLRGASGK 260

  Fly   343 SPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKD-IRIEPCGHLLCTPCLTSWQVDSEGQGCP 406
            ..||...|...|:          ...|.||.:...| |.::||.|..|..|.:.|.  .....||
Zfish   261 EKTEGATTDKMEE----------SLTCIICQDLLYDCISVQPCMHTFCAACYSGWM--ERSSFCP 313

  Fly   407 FCRAEIKGTEQIVVDAFDPRKQH--NRNVTNGRQQQQEEDDTEDIGDFNIATSSLHALSTSSTVA 469
            .||..:   |:|       ||.|  |..|.....|..|:..|||         .|.::...:.:.
Zfish   314 TCRCPV---ERI-------RKNHILNNLVEAYLLQHPEKCRTED---------DLRSMDARNKIT 359

  Fly   470 AEKHSPHTSPRLGRRSTTPSLM--AVQNDLYAGGTPTLSLPSSSC-----------SSIAAASTS 521
            .:...|...........:...:  ...||   .....:|.|...|           |::....::
Zfish   360 QDMLQPKVERSFSDEEASSDYLFELSDND---SDISDMSQPYMMCRQCPGYRKELSSALWICESA 421

  Fly   522 SSSSLASVATVAASTSS-SQHQQPQP-SAPPASAVL 555
            .|.|||..|....|||| |....||. ..||.::.|
Zfish   422 QSESLAKTAGDGPSTSSDSTTAAPQEFRCPPQASHL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 15/61 (25%)
zf-C3HC4_3 367..415 CDD:290631 15/48 (31%)
UBA_Cbl_like 834..873 CDD:270503
chfrNP_001093485.1 FHA 10..98 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..172
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..267 17/70 (24%)
RING 276..319 CDD:238093 15/44 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..447 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.