DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and RNF114

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_061153.1	Gene:	RNF114 / 55905	HGNCID:	13094	Length:	228	Species:	Homo sapiens

Alignment Length:	111	Identity:	23/111 - (20%)
Similarity:	36/111 - (32%)	Gaps:	49/111 - (44%)

- Green bases have known domain annotations that are detailed below.

  Fly   369 CKICAE-NDKDIRIEPCGHLLCTPCLTSW--------------------------QVDSEGQGCP 406
            |.:|.| .:|.::: ||||:.|:.||...                          |::|....|.
Human    29 CPVCLEVYEKPVQV-PCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAVELERQIESTETSCH 92

  Fly   407 FCRAE--------------------IKGTEQIVVDA-FDPRKQHNR 431
            .||..                    ::|.:..:.|| ..||...||
Human    93 GCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNR 138

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176
		zf-C3HC4_3	367..415	CDD:290631	16/92 (17%)
		UBA_Cbl_like	834..873	CDD:270503
RNF114	NP_061153.1	RING-HC_RNF114	27..68	CDD:319454	11/39 (28%)
		RING-HC finger (C3HC4-type)	29..67	CDD:319454	11/38 (29%)
		zf-Di19	140..200	CDD:310299
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910