DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and rnf130

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_009289393.1 Gene:rnf130 / 553950 ZFINID:ZDB-GENE-050522-525 Length:428 Species:Danio rerio


Alignment Length:199 Identity:46/199 - (23%)
Similarity:78/199 - (39%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 FQLCKICAE----NDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIV-----VD 421
            |..|.:|.|    ||. :||.||.|:....|:..|.  :|...||.|:..|.....::     ||
Zfish   270 FNHCAVCIEGYQLNDV-VRILPCKHVFHKMCVDPWL--NEHCTCPMCKLNILKALGVMPNLPCVD 331

  Fly   422 --AFDPRKQHNRNVTNGRQQQQEEDDTEDIGDFNIATSSLHALSTSSTVAAE--KHSPHTSPRLG 482
              |||..:. :|:.|:.::                  ::|..||:.::::.|  :||        
Zfish   332 NMAFDMDRM-SRSQTSSQR------------------TALVDLSSETSISLEPLRHS-------- 369

  Fly   483 RRSTTPSLMAVQNDLYAGGTPTLSLPSSSCSSIA-------AASTSSSSSLASVATVAASTSSSQ 540
            ..|..||    ..:|         :|.|...:||       .||....|:|.....:..:|:|:.
Zfish   370 SSSQLPS----DEEL---------IPRSGEINIAVTKEWFIVASFGVLSALTLCYMIIRATASTT 421

  Fly   541 HQQP 544
            :.:|
Zfish   422 NYEP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 17/51 (33%)
UBA_Cbl_like 834..873 CDD:270503
rnf130XP_009289393.1 PA_GRAIL_like 49..188 CDD:239037
zf-RING_2 271..314 CDD:290367 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.