DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and CG8141

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster


Alignment Length:123 Identity:27/123 - (21%)
Similarity:41/123 - (33%) Gaps:61/123 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAEND---------------KDIR 380
            :.|.||||:|         .|.|:|.:                |||               :::.
  Fly    40 KGYIPDLSNA---------NVNQQQQQ----------------ENDGEDDLLPGTRLRYRRRNLH 79

  Fly   381 IEP-----------------CGHLLCTPCLTSW-QVDSEGQ-GCPFCRAEIKGTEQIV 419
            ::|                 ||||.|..||  | ::....| .||.|:..:...|.|:
  Fly    80 LDPYVCNECNQYVRGGVITICGHLFCWTCL--WPKLSGTAQPRCPCCQRHLLMYEDIM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 5/8 (63%)
zf-C3HC4_3 367..415 CDD:290631 16/81 (20%)
UBA_Cbl_like 834..873 CDD:270503
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.