Sequence 1: | NP_648224.1 | Gene: | Cbl / 38961 | FlyBaseID: | FBgn0020224 | Length: | 878 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998393.2 | Gene: | rnft1 / 406509 | ZFINID: | ZDB-GENE-040426-2324 | Length: | 419 | Species: | Danio rerio |
Alignment Length: | 236 | Identity: | 46/236 - (19%) |
---|---|---|---|
Similarity: | 81/236 - (34%) | Gaps: | 85/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 WQILAVTHPGYVAFLTYD---------------------EV--KARLQRYILKAGSYVFR----- 282
Fly 283 --------LSCTRLGQW-----AIG--------------YVTAEGEILQTIPQNKSLCQALLDGH 320
Fly 321 REGFYLYP-DGQA-------YNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDK 377
Fly 378 DIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQI 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cbl | NP_648224.1 | Cbl_N | 42..163 | CDD:280432 | |
Cbl_N2 | 167..250 | CDD:280857 | 1/3 (33%) | ||
SH2_Cbl-b_TKB | 244..340 | CDD:198176 | 25/156 (16%) | ||
zf-C3HC4_3 | 367..415 | CDD:290631 | 15/47 (32%) | ||
UBA_Cbl_like | 834..873 | CDD:270503 | |||
rnft1 | NP_998393.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..120 | ||
Required for ubiquitin ligase activity and for protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q5M7Z0 | 352..403 | 18/69 (26%) | |||
RING | 359..400 | CDD:238093 | 14/42 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |