DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and rnft1

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_998393.2 Gene:rnft1 / 406509 ZFINID:ZDB-GENE-040426-2324 Length:419 Species:Danio rerio


Alignment Length:236 Identity:46/236 - (19%)
Similarity:81/236 - (34%) Gaps:85/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 WQILAVTHPGYVAFLTYD---------------------EV--KARLQRYILKAGSYVFR----- 282
            |.:|.:|....:.|.|:.                     ||  ...:..:|||   ::|.     
Zfish   191 WLLLFLTSSSLLVFYTFHTQSLYRCLFFANATIDYHNFWEVLWSVGVTNFILK---FIFMGFKCL 252

  Fly   283 --------LSCTRLGQW-----AIG--------------YVTAEGEILQTIPQNKSLCQALLDGH 320
                    ::..|.|||     .:|              |:.:..|:..::.....:..|||...
Zfish   253 ILLVPCPLMTYRRRGQWYMLIEEVGQLYQVIAPVPLWFRYLVSYDEMDTSVGLTLGILLALLYLI 317

  Fly   321 REGFYLYP-DGQA-------YNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDK 377
            .:...||. .|..       ::|:::.|..||.:..            |.|   .:|.||..:.|
Zfish   318 MKLLALYGLSGSLQKTLRTFFSPEVNGAPASPAQIR------------EAG---DICPICQADFK 367

  Fly   378 DIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQI 418
            ..|:..|.|:.|..|:..|.  ::.:.||.||..|  |:::
Zfish   368 QPRVLVCQHIFCEECIAQWL--NQERTCPLCRTVI--TDKV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857 1/3 (33%)
SH2_Cbl-b_TKB 244..340 CDD:198176 25/156 (16%)
zf-C3HC4_3 367..415 CDD:290631 15/47 (32%)
UBA_Cbl_like 834..873 CDD:270503
rnft1NP_998393.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..120
Required for ubiquitin ligase activity and for protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q5M7Z0 352..403 18/69 (26%)
RING 359..400 CDD:238093 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.