DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and rnf185

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_998202.1	Gene:	rnf185 / 406310	ZFINID:	ZDB-GENE-040426-1977	Length:	194	Species:	Danio rerio

Alignment Length:	98	Identity:	35/98 - (35%)
Similarity:	46/98 - (46%)	Gaps:	18/98 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   364 STFQLCKICAENDKDIRIEPCGHLLCTPCLTSW-QVDSEGQGCPFCRAEIKGTEQIVVDAF---- 423
            |||: |.||.:..||..|..||||.|.|||..| :.....|.||.|:|.|  :...|:..:
Zfish    37 STFE-CNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGI--SRDKVIPLYGRGS 98

  Fly   424 ----DPRKQHNRNVTNGRQQQQEEDDTEDIGDF 452
                |||::     |..|.|.| ..:.|:.|.|
Zfish    99 TGQQDPREK-----TPPRPQGQ-RPEPENRGGF 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176
		zf-C3HC4_3	367..415	CDD:290631	21/48 (44%)
		UBA_Cbl_like	834..873	CDD:270503
rnf185	NP_998202.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250\|UniProtKB:Q96GF1	31..82		21/45 (47%)
		RING	40..85	CDD:238093	20/45 (44%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	92..126		10/40 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910