DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and Lonrf2

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_001025049.2	Gene:	Lonrf2 / 381338	MGIID:	1920209	Length:	754	Species:	Mus musculus

Alignment Length:	137	Identity:	26/137 - (18%)
Similarity:	46/137 - (33%)	Gaps:	26/137 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   328 PDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPC 392
            |...|.:|...:|.....|...|:....:|           |.:|.....:....||||..|..|
Mouse   419 PKKDADSPPQRNASSLEEEPEFTIDATDFE-----------CALCMRLLFEPVTTPCGHTFCLKC 472

  Fly   393 LTSWQVDSEGQGCPFCRAEIKG------------TEQIVVDAFDPRKQHNRNVTNGRQQQQEEDD 445
            |.  :.......||.|:.::..            ||:::. .:.|.:..:|......:..:..:.
Mouse   473 LE--RCLDHAPHCPLCKDKLSELLATRNFNVTVLTEELIF-RYLPDELSDRKRVYDEEMSELSNL 534

  Fly   446 TEDIGDF 452
            |.|:..|
Mouse   535 TRDVPIF 541

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176	3/11 (27%)
		zf-C3HC4_3	367..415	CDD:290631	12/59 (20%)
		UBA_Cbl_like	834..873	CDD:270503
Lonrf2	NP_001025049.2	TPR_16	27..90	CDD:338738
		RING1-HC_LONFs	136..>161	CDD:319427
		TPR repeat	223..253	CDD:276809
		TPR repeat	258..281	CDD:276809
		RING2-HC_LONFs	446..487	CDD:319428	12/53 (23%)
		RING-HC finger (C3HC4-type)	449..486	CDD:319428	11/38 (29%)
		LON_substr_bdg	538..738	CDD:308028	1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910