DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and Pcgf2

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001099306.1 Gene:Pcgf2 / 287662 RGDID:1305097 Length:342 Species:Rattus norvegicus


Alignment Length:315 Identity:59/315 - (18%)
Similarity:95/315 - (30%) Gaps:108/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LCKICAENDKD-IRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTE--------------- 416
            :|.:|.....| ..|..|.|..|..|:..:.  ...:.||.|..::..|.               
  Rat    17 MCALCGGYFIDATTIVECLHSFCKTCIVRYL--ETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIV 79

  Fly   417 -QIVVDAFDPRKQHNRN---------VTNGRQQQQE---EDDTEDIGDFNIATSSLH-------- 460
             ::|...|....:..|:         |.||..:.:.   |.:...:||..|.:.|:.        
  Rat    80 YKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVRDR 144

  Fly   461 ----ALSTSSTVAAEK------HSP------HTSPRLGRRSTTPSLMAVQ--------NDLYA-- 499
                :|..:.....||      ..|      |.:..|..:...||...|:        .:.|.  
  Rat   145 EEKKSLVENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEILYEDEPLKEYYTLM 209

  Fly   500 ----------GG----------------TPTLSLPS--------SSCSSIA------AASTSSSS 524
                      .|                .||:..||        |.|.|::      |...::||
  Rat   210 DIAYIYPWRRNGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSS 274

  Fly   525 SLASVATVAASTSSSQ---HQQPQPSAPPASAVLSNGGGGGGGGGASSSQKNTNR 576
            ||.|.||.:..:.||.   ...|....||::|..:.....||......:..:|:|
  Rat   275 SLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 11/47 (23%)
UBA_Cbl_like 834..873 CDD:270503
Pcgf2NP_001099306.1 RING-HC_PCGF4 12..65 CDD:319650 12/49 (24%)
RAWUL_PCGF2 130..228 CDD:340684 13/97 (13%)
PHA03247 <222..304 CDD:223021 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.