DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and pas4

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_595592.1 Gene:pas4 / 2539774 PomBaseID:SPBC17A3.10 Length:306 Species:Schizosaccharomyces pombe


Alignment Length:286 Identity:53/286 - (18%)
Similarity:101/286 - (35%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SLVFSHMLSELKAIFPNGVFAGDQFRITKADAADFWKSNFGNSTLVPWKIFRQELNKVHPIISGL 207
            ||:|| ::.:|..:..|.:       :.:|..:..:|..||...|:|..:..:|.:.|: |::..
pombe   100 SLIFS-LVIDLVGVHVNKL-------LKQASYSSSFKLPFGLRNLLPEAVISKEKHLVY-ILNSF 155

  Fly   208 EAMALKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNWQILAVTHPGYVA----------FLTY 262
            :.:.||.                         |:::|   .|.:|..|:.|          :::.
pombe   156 KPILLKL-------------------------VSIIR---FLCLTMKGHCATVSQLLLGLKYISL 192

  Fly   263 DEV----KARLQRYILKAGS----YVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDG 319
            ||:    |.::...:|..||    .:.:.|.:...|..|..:|.|.::     ::|:....:.:|
pombe   193 DEINPEEKKKVLTLLLLLGSRLIASILQHSNSYFDQHTISSITDERDL-----EDKNKLPFIPEG 252

  Fly   320 HREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPC 384
            :|:                                     |.:...|..|....|         |
pombe   253 NRK-------------------------------------CSLCMEFIHCPAATE---------C 271

  Fly   385 GHLLCTPCLTSWQVDSEGQGCPFCRA 410
            ||:.|..|:..|  .|:...||.|||
pombe   272 GHIFCWSCINGW--TSKKSECPLCRA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 6/19 (32%)
Cbl_N2 167..250 CDD:280857 13/82 (16%)
SH2_Cbl-b_TKB 244..340 CDD:198176 19/113 (17%)
zf-C3HC4_3 367..415 CDD:290631 14/44 (32%)
UBA_Cbl_like 834..873 CDD:270503
pas4NP_595592.1 PEX10 1..306 CDD:227861 53/286 (19%)
RING 255..295 CDD:238093 14/87 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.