DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and SPBC14F5.10c

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_596736.1 Gene:SPBC14F5.10c / 2539750 PomBaseID:SPBC14F5.10c Length:486 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:37/149 - (24%)
Similarity:57/149 - (38%) Gaps:36/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 YPDGQAYNPDLSSAVQS-----PTEDHITVTQEQYEL----YCEMGSTFQ-------LCKICAEN 375
            :.|..:.:|..:||:..     ||..::..:...||.    :..|....|       .|:||...
pombe   111 HDDCLSSSPPCTSALTEITLLPPTFHNLIPSSSSYETAVAEFLHMEDLLQENVSRELECQICFGM 175

  Fly   376 DKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRKQHNRNVTN----- 435
            ..|..:.||||..|.|||  .|..::...||.||.   |....||  .:..|.|  ::|.     
pombe   176 LYDPVVSPCGHTFCGPCL--MQALTQSPQCPTCRF---GLPSPVV--LEHAKSH--SITTFLRDF 231

  Fly   436 ------GRQQQQEEDDTED 448
                  .||:..||:..::
pombe   232 YPDNWLERQKSWEEEKEQE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 2/12 (17%)
zf-C3HC4_3 367..415 CDD:290631 18/54 (33%)
UBA_Cbl_like 834..873 CDD:270503
SPBC14F5.10cNP_596736.1 RING 168..207 CDD:238093 15/40 (38%)
LON_substr_bdg 252..470 CDD:280370
LON 259..485 CDD:225362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.