DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and Dtx3l

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001013389.2 Gene:Dtx3l / 209200 MGIID:2656973 Length:748 Species:Mus musculus


Alignment Length:486 Identity:94/486 - (19%)
Similarity:147/486 - (30%) Gaps:170/486 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPD----TYQ 81
            :.|:|..:||    |.|..::|.     |..::..|...|     |::||.:....||    ...
Mouse   194 IEKIHHFLSE----QLLEREQKR-----KGSEQKRKCAPQ-----KHTPPDVEREPPDQSSIQVP 244

  Fly    82 RLRLIYSKNEDQMHLLHANEHFNVFIN------NLM-----------------------RKCKQA 117
            .|.|.|.|:.:...|......|.|.|.      |::                       :||.|:
Mouse   245 VLLLEYFKHVNPGRLEFIEYKFGVNIEIQASSPNMVTVGFTSSPFGNVEEASQSFVRDFQKCSQS 309

  Fly   118 IKLFKEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRIT----KADAADFW 178
            :      |:.......|.|.         ..:..||...||..:..|....:|    .||.:...
Mouse   310 L------KQDCISLEEHQRA---------KEVRQELSRCFPKLLIKGQGRTLTLLGSPADISAAT 359

  Fly   179 KSNFGNSTLVPWKI---------------FR-------QELNKVHPIIS---GLEAMALKTTI-- 216
            :.......|.|.||               |:       ||::::....:   .::....||.|  
Mouse   360 EKVSQGLGLRPVKITASGYTTGIEVDSTRFKLLEPELLQEISEIEQKFNTRGKVQEKGQKTCILF 424

  Fly   217 -------DLTCNDFISNFEFDVFTRLFQPWVTLLRNWQILAV---------------------TH 253
                   ||:...:..      ||..||.....||. ::|::                     .|
Mouse   425 VPKDKDLDLSVQSYTG------FTDAFQRATWQLRT-EVLSLKGLGKERARLHNTKFADNFKKEH 482

  Fly   254 PGYVAFLTYDE--VKARLQRYILKAGSYVFRLSCTRLGQWAIGYVTAEGEIL---QTIPQNKSLC 313
            |. |.|:|..|  ....|..::.:|..||.:         .:|...:.||.|   |..|...|..
Mouse   483 PN-VHFVTSQESVTLTGLPHHLAQAMQYVSK---------RMGLAPSSGEKLAMDQETPMEISSS 537

  Fly   314 QALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKD 378
            ....|.........|.|.:.:|    |....|||:                    |.||.:...:
Mouse   538 DPHGDQQENAALPAPRGTSSSP----AASKGTEDY--------------------CVICMDTISN 578

  Fly   379 IRIEP-CGHLLCTPCLTSWQVDSEGQGCPFC 408
            ..:.| |.|..||.|::...:..  ..||.|
Mouse   579 KHVLPKCKHEFCTSCISKAMLIK--PVCPVC 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 28/153 (18%)
Cbl_N2 167..250 CDD:280857 21/120 (18%)
SH2_Cbl-b_TKB 244..340 CDD:198176 23/121 (19%)
zf-C3HC4_3 367..415 CDD:290631 12/43 (28%)
UBA_Cbl_like 834..873 CDD:270503
Dtx3lNP_001013389.2 RRM1_PAR14 8..86 CDD:240746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..238 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..562 8/37 (22%)
RING 569..607 CDD:238093 11/39 (28%)
Deltex_C 616..746 CDD:193607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.