DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and LONRF2

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_940863.3	Gene:	LONRF2 / 164832	HGNCID:	24788	Length:	754	Species:	Homo sapiens

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	40/92 - (43%)	Gaps:	10/92 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   327 YPDGQAYNPDLSSAVQSPTED------HITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCG 385
            :||.....|||::..:.|.:|      ..:.|:|...|..:: :.|: |.:|.....:....|||
Human   403 FPDDVEDAPDLNAPGKIPKKDLSLQRSPNSETEESQGLSLDV-TDFE-CALCMRLLFEPVTTPCG 465

  Fly   386 HLLCTPCLTSWQVDSEGQGCPFCRAEI 412
            |..|..||.  :.......||.|:.::
Human   466 HTFCLKCLE--RCLDHAPHCPLCKDKL 490

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176	5/12 (42%)
		zf-C3HC4_3	367..415	CDD:290631	12/46 (26%)
		UBA_Cbl_like	834..873	CDD:270503
LONRF2	NP_940863.3	TPR 1	23..58
		TPR_16	27..92	CDD:372602
		TPR 2	59..91
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	112..136
		RING1-HC_LONFs	143..174	CDD:319427
		TPR 3	197..230
		TPR repeat	200..225	CDD:276809
		TPR repeat	230..260	CDD:276809
		TPR 4	231..264
		TPR repeat	265..293	CDD:276809
		TPR 5	266..298
		PEX10	<380..489	CDD:227861	23/89 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	398..439		9/35 (26%)
		RING2-HC_LONFs	446..487	CDD:319428	12/43 (28%)
		TPR 6	447..483		10/38 (26%)
		RING-HC finger (C3HC4-type)	449..486	CDD:319428	11/38 (29%)
		LON_substr_bdg	538..738	CDD:366967
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910