DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and TRIM50

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001268380.1 Gene:TRIM50 / 135892 HGNCID:19017 Length:487 Species:Homo sapiens


Alignment Length:341 Identity:72/341 - (21%)
Similarity:113/341 - (33%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 CKICAENDKDIRIEPCGHLLCTPCLT--SWQVDSEGQGCPFCRAEIKGTEQI-------VVDAF- 423
            |.||.|..|:..:..|||..|..||.  |..:|:|.: ||.||..:.|:..:       |::|. 
Human    16 CPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELR-CPVCRQAVDGSSSLPNVSLARVIEALR 79

  Fly   424 ---DPRKQ---HNRNVTNGRQQQQEEDDTEDIGDFNIATSSLHALSTSSTVAAEKHSPHTSPRLG 482
               ||..:   |:||..:...::.:|           ....|..|     :.:.:|.|.|..   
Human    80 LPGDPEPKVCVHHRNPLSLFCEKDQE-----------LICGLCGL-----LGSHQHHPVTPV--- 125

  Fly   483 RRSTTPSLMAVQNDLYAGGTPTLSLPSSSCSSIAAASTSSSSSLASVATVAASTSSSQHQQPQPS 547
              ||..|.|   .:..|.....|.........:.|...::.:.:.:.:.|.:.....:.|:....
Human   126 --STVYSRM---KEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELHHL 185

  Fly   548 APPASAVLSNGGGGGGGGGASS-------SQKNTNRMSAPLIGSCVANSTYG--------QKLPQ 597
            .....|....|.||...|..:|       :|....|::.   ..||... :|        :|...
Human   186 VDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQ---AECVLEQ-FGNEDHHKFIRKFHS 246

  Fly   598 NCSHSSTSSSSDNASSSSSYAILQNLHDTGTPATA----AAVVAPPLPPRKSSPGVETPSKATAP 658
            ..|.:....:.....:.|..:....||......|.    ...|.|...|.|..|       |||.
Human   247 MASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDP-------ATAH 304

  Fly   659 PPPSSSKSIDNIQCSL 674
            |....||....:||.|
Human   305 PLLELSKGNTVVQCGL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 18/47 (38%)
UBA_Cbl_like 834..873 CDD:270503
TRIM50NP_001268380.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 17/42 (40%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 16/40 (40%)
BBOX 90..125 CDD:237988 9/50 (18%)
SPRY_PRY_TRIM50 283..469 CDD:293977 14/45 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.