DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AgaP_AGAP000928

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_003437137.1 Gene:AgaP_AGAP000928 / 1270411 VectorBaseID:AGAP000928 Length:335 Species:Anopheles gambiae


Alignment Length:417 Identity:87/417 - (20%)
Similarity:153/417 - (36%) Gaps:94/417 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQPKMNLKNS-PPFILDILPDTYQRLR 84
            :|..|....:|.:.:.:..|::.:|.....:.:|:.|..|......|: ...:.::|...|..|.
Mosquito     1 MSLFHANAGQAEIIRTVQKDQEHIEYVRAALSEVLLLLSQRHWFRYNALCKLVAEVLYHHYAILH 65

  Fly    85 LIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLFKE-GKEKMFDENSHYRRNLTKLSLVFSH 148
            .:.:..|:...::..:.::.:..|    |..|.:.:..| |.|.:.|      |.||.|......
Mosquito    66 NLQTLGEEYTGIIQVDANYVMLPN----KALQLLAILLEYGGEHVVD------RVLTYLQTEIDR 120

  Fly   149 MLSELKAIFPNGVFAGDQFRITKADAADFWKSNFGNSTLVPW-KIFRQELNKVHPIISGLEAMAL 212
            ....|:::........|..|:                 :||: :.|...|..:|   .|...::.
Mosquito   121 SEELLESVKTGLHKLIDTLRV-----------------VVPYVRGFHTSLFYIH---GGKYHISK 165

  Fly   213 KTTIDLTCNDFISNFEFD---VFTRLFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYIL 274
            :    ||..:::|.|..|   :|.|:..|.:..|   .:|.|| ||....:          |..|
Mosquito   166 R----LTGINYVSFFLRDLACLFYRVLPPALLCL---FLLPVT-PGLQVLI----------RNWL 212

  Fly   275 KAGSYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQA--YNPDL 337
            |....|:       |..|:||||....:|           ||...:::  |.....||  ..|.:
Mosquito   213 KEDHSVY-------GYKALGYVTLTQLVL-----------ALAARYQQ--YRSQPSQAKVVAPSV 257

  Fly   338 SSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEG 402
            .||.:|.|.......:.              |.:|.:..:.|.:..||||.|..|:..|.  .:.
Mosquito   258 RSAERSRTASGTLPGRN--------------CALCMDTAQAITVTQCGHLFCWQCILHWL--DQR 306

  Fly   403 QGCPFCRAEIKGTEQIVVDAF--DPRK 427
            |.||.||..:|.|..:.:..|  :|.:
Mosquito   307 QVCPICRESVKKTRVVRLQNFSVEPER 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432 21/122 (17%)
Cbl_N2 167..250 CDD:280857 16/86 (19%)
SH2_Cbl-b_TKB 244..340 CDD:198176 22/97 (23%)
zf-C3HC4_3 367..415 CDD:290631 16/47 (34%)
UBA_Cbl_like 834..873 CDD:270503
AgaP_AGAP000928XP_003437137.1 Pex2_Pex12 20..246 CDD:282595 58/293 (20%)
RING 275..316 CDD:238093 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.