DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and AgaP_AGAP006900

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_308856.3 Gene:AgaP_AGAP006900 / 1270179 VectorBaseID:AGAP006900 Length:899 Species:Anopheles gambiae


Alignment Length:201 Identity:37/201 - (18%)
Similarity:57/201 - (28%) Gaps:87/201 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 IPQNKSLCQAL---LDGHREG---FYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGS 364
            |||..:..::|   |||..:.   ....|...|.||.|...                       |
Mosquito   447 IPQASARLKSLLERLDGELQSARWLDTTPVRLAVNPSLIEP-----------------------S 488

  Fly   365 TFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFC--------RAEIKGT------ 415
            .|. |.:|........:.||||..|..||.  :.......||.|        |:.:.|:      
Mosquito   489 DFD-CVLCCRTLWRPVVTPCGHTYCWVCLD--RCMDYSSSCPLCMAPLVEQFRSHLPGSAATPPE 550

  Fly   416 -----------------------------EQIVVDAFDPRKQHNRNVTNGRQQQQEEDDTEDIGD 451
                                         ::.:.:|::            |:||||:|....:..
Mosquito   551 AAAAGPASPSTNLISLAKRKMTRFVDLAMQRFIPEAYE------------RRQQQEQDREPTVPV 603

  Fly   452 FNIATS 457
            |...|:
Mosquito   604 FICTTA 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176 12/39 (31%)
zf-C3HC4_3 367..415 CDD:290631 13/55 (24%)
UBA_Cbl_like 834..873 CDD:270503
AgaP_AGAP006900XP_308856.3 RING 41..>67 CDD:302633
TPR_11 161..227 CDD:290150
TPR repeat 162..190 CDD:276809
TPR repeat 195..225 CDD:276809
RING 491..533 CDD:238093 12/44 (27%)
LON_substr_bdg 600..805 CDD:280370 2/10 (20%)
LON 600..805 CDD:271862 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.