DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and ftr97

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_002665768.3 Gene:ftr97 / 100150342 ZFINID:ZDB-GENE-061026-1 Length:794 Species:Danio rerio


Alignment Length:162 Identity:35/162 - (21%)
Similarity:50/162 - (30%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 DHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTS-WQVDSEG-QGCPFCR 409
            ||     :||.           |.:|.:..:|....||||..|..|:.. |..|.:. ..||.||
Zfish     7 DH-----DQYS-----------CSVCLDLLRDPVTIPCGHSYCMSCINECWNKDQKAPYKCPQCR 55

  Fly   410 AEIKGTEQIVVDAFDPRKQHNRNVTNGRQQQQ---EEDDTEDIGDFNIAT-----SSLHALSTSS 466
                       ..|..:...||:.......::   :|......|...||.     .|:.|:.:..
Zfish    56 -----------HTFSSKPPLNRSTVLAELMEKLRAQESPQSPAGPGEIACDFCVGESIKAVKSCM 109

  Fly   467 TVAAEKHSPHTSPR----------LGRRSTTP 488
            ...|.....|..|.          |.:.||.|
Zfish   110 ECRASYCELHVQPHYNVPALRKHVLVKASTIP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 15/49 (31%)
UBA_Cbl_like 834..873 CDD:270503
ftr97XP_002665768.3 zf-C3HC4_4 13..54 CDD:291880 13/40 (33%)
zf-B_box 138..177 CDD:279037 3/4 (75%)
DUF4200 183..299 CDD:290574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.