DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbl and ftr57

DIOPT Version :9

Sequence 1:NP_648224.1 Gene:Cbl / 38961 FlyBaseID:FBgn0020224 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_005161990.1 Gene:ftr57 / 100005871 ZFINID:ZDB-GENE-090312-35 Length:548 Species:Danio rerio


Alignment Length:68 Identity:22/68 - (32%)
Similarity:30/68 - (44%) Gaps:14/68 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LCKICAENDKDIRIEPCGHLLCTPCLTS-W--QVDSEGQGCPFCRAEIKGTEQIVVDAFDPRKQH 429
            :|.:|.:..||....||||..|..|:|. |  :.|.....||.||           :||:||...
Zfish    12 MCPVCLDLLKDPVTIPCGHSYCKTCITGCWDQEDDKRVYSCPQCR-----------EAFNPRPAL 65

  Fly   430 NRN 432
            .:|
Zfish    66 AKN 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CblNP_648224.1 Cbl_N 42..163 CDD:280432
Cbl_N2 167..250 CDD:280857
SH2_Cbl-b_TKB 244..340 CDD:198176
zf-C3HC4_3 367..415 CDD:290631 17/49 (35%)
UBA_Cbl_like 834..873 CDD:270503
ftr57XP_005161990.1 zf-C3HC4_4 13..55 CDD:291880 15/41 (37%)
BBOX 147..179 CDD:197662
Prefoldin 187..288 CDD:298833
SPRY_PRY_SNTX 373..548 CDD:294002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.