DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and AT3G56320

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001327113.1 Gene:AT3G56320 / 824799 AraportID:AT3G56320 Length:603 Species:Arabidopsis thaliana


Alignment Length:391 Identity:85/391 - (21%)
Similarity:149/391 - (38%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QLRQRLNAITKLFNSAQSQSERQELREAL-----------EW--SESGGH--LCTVLNFFACDLE 99
            ::::||:    :.:|:.|.|....|..||           .|  :|...|  |||:......| .
plant     3 EIQERLS----VSSSSSSSSSSLSLSTALPKGDSLPIDADSWMIAEERAHEILCTIQPALVSD-R 62

  Fly   100 NMKTCFGHVRNCIEKEMRGRVRVFPFGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHF 164
            :......:||..|... .| :.||.|||:.....|.:.||||.:....|....|:.||.::..:.
plant    63 SRNEIIDYVRTLIMSH-EG-IEVFSFGSVPLKTYLPDGDIDLTVLTKQNMDDDFYGQLCSRLQNE 125

  Fly   165 LRRSKCFADVFTIRHASVPIIRCKHQLTGLNIDINMSNPNSIYNSRF---VGELMFRNERIRELC 226
            .|.|:..|.......|.|.:|:|  .:..:.:||:.:....:....|   |.:|..|:...:...
plant   126 ERESEFHATDVQFIPAQVKVIKC--NIRNIAVDISFNQTAGLCALCFLEQVDQLFGRDHLFKRSI 188

  Fly   227 LFLKIWA---KKLKLISHGGMTSYCLISLI--IVNLQVNRLVPSVKELQSLCPPVILSGVNYAYS 286
            :.:|.|.   .::...:.|.:::|.|..|:  |:||                           :.
plant   189 ILVKAWCYYESRILGANTGLISTYALAVLVLYIINL---------------------------FH 226

  Fly   287 LDLTPPIPARLTTLDLLKNFFIYYCTVNFDKSVLSPFLGGCVD----KETTLGMPGGFPEYDEQQ 347
            ..|:.|       |.:|..|..||.:.:::...:|  :.|.|.    .|.|...|....|....:
plant   227 SSLSGP-------LAVLYKFLDYYGSFDWNNYCIS--VNGPVPISSLPELTAASPENGHELLLDE 282

  Fly   348 KLVHDAI---GAPPDAFQLD------RAMCVQDPFELSRNVAKSVSISNLCYFRQCLVLAAQACS 403
            |.:.:.:   .||..|...:      :.:.:.||.:.|.|:.|||:..|:...|....|.|:...
plant   283 KFLRNCVELYSAPTKAVDSNGLEFPIKHLNIVDPLKYSNNLGKSVTQGNVQRIRHAFTLGARKLR 347

  Fly   404 D 404
            |
plant   348 D 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 29/114 (25%)
AT3G56320NP_001327113.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2687
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.