DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and AT3G51620

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_850678.2 Gene:AT3G51620 / 824325 AraportID:AT3G51620 Length:829 Species:Arabidopsis thaliana


Alignment Length:341 Identity:73/341 - (21%)
Similarity:127/341 - (37%) Gaps:94/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VFPFGSLVTGLALKESDIDLFLEPNGNQPPLFHNQ--------LYNKTSHFLRRSKCFADVFTIR 178
            |..|||:.....|.:.||||.....     |:|.:        :..:..|.|.......||..||
plant    77 VHSFGSVPLKTYLPDGDIDLTAFGG-----LYHEEELAAKVFAVLEREEHNLSSQFVVKDVQLIR 136

  Fly   179 HASVPIIRCKHQLTGLNIDINMSNPNSIYNSRF---VGELMFRNERIRELCLFLKIWA---KKLK 237
             |.|.:::|..|  .:.:||:.:....|....|   :..|:.::...:...:.:|.|.   .::.
plant   137 -AEVKLVKCLVQ--NIVVDISFNQIGGICTLCFLEKIDHLIGKDHLFKRSIILIKAWCYYESRIL 198

  Fly   238 LISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPP--VILSGVNY-------AYSLDLTPPI 293
            ...||.:::|.|.:|:   |.:..|..|     ||..|  |:...::|       :|.:.|..|:
plant   199 GAFHGLISTYALETLV---LYIFHLFHS-----SLNGPLAVLYKFLDYFSKFDWDSYCISLNGPV 255

  Fly   294 PARLTTL-------------DLLKNFFIYYCTVNFDKSVLSPFLGGCVDKETTLGMPG-GFPEYD 344
              .|::|             |||               :.|.||..|::   ...:|. ||.   
plant   256 --CLSSLPDIVVETPENGGEDLL---------------LTSEFLKECLE---MYSVPSRGFE--- 297

  Fly   345 EQQKLVHDAIGAPPDAFQLDRAMCVQDPFELSRNVAKSVSISNLCYFRQCLVLAAQAC------S 403
                       ..|..|| .:.:.:.||.:.:.|:.:|||..|....|......|:..      |
plant   298 -----------TNPRGFQ-SKHLNIVDPLKETNNLGRSVSKGNFYRIRSAFTYGARKLGQLFLQS 350

  Fly   404 DQELTSQPEKLYDYLL 419
            |:.::|:..|.:..:|
plant   351 DEAISSELRKFFSNML 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 25/104 (24%)
AT3G51620NP_850678.2 NT_PAP_TUTase 57..163 CDD:143392 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2687
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.