DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and AT3G45750

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_190161.2 Gene:AT3G45750 / 823717 AraportID:AT3G45750 Length:682 Species:Arabidopsis thaliana


Alignment Length:173 Identity:44/173 - (25%)
Similarity:74/173 - (42%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 FGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRRSKC-----FA------------ 172
            :||.|..:...:||:|:.:            ...|.||...|..|.     ||            
plant    92 YGSFVMDMYSSQSDLDVSI------------NFGNGTSEIPREKKLEILKRFAKKLRSLQGEGQV 144

  Fly   173 -DVFTIRHASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLKIWAKKL 236
             :|.:|..|.|||::...|.||:..|:::.|.:.|.||:.|..:...:.|.::|||.:|.|||..
plant   145 KNVESIFSAKVPIVKFSDQGTGVECDLSVENKDGILNSQIVRIISQIDGRFQKLCLLVKHWAKAH 209

  Fly   237 KLIS--HGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVI 277
            ::.|  |..:.|..:..|:.::||...            ||::
plant   210 EVNSALHRTLNSVSITLLVALHLQTQN------------PPIL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 28/108 (26%)
AT3G45750NP_190161.2 TRF4 14..>353 CDD:227585 44/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.