DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and TENT4B

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001352253.1 Gene:TENT4B / 64282 HGNCID:30758 Length:713 Species:Homo sapiens


Alignment Length:284 Identity:73/284 - (25%)
Similarity:111/284 - (39%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VRNCIE---KEMRGRVRVFPFGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRRSK 169
            |.|.||   ||:.....|..|||..|||.|..|||||.:.......||:      .....||:.|
Human   238 VVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLW------TLEEALRKHK 296

  Fly   170 CFAD---VFTIRHASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLK- 230
             .||   |..:..|:||||:.....|.:.:||:.:..|.:..:..:.:...:...:..|.|.|| 
Human   297 -VADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQ 360

  Fly   231 -IWAKKLKLISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIP 294
             :..:.|..:..||:.||.|..:.:..||::       ..:..|.|    ..||..         
Human   361 FLLQRDLNEVFTGGIGSYSLFLMAVSFLQLH-------PREDACIP----NTNYGV--------- 405

  Fly   295 ARLTTLDLLKNFF-IYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGFPEYDEQQKLVHDAIGAPP 358
                   ||..|| :|....|:.|:       |...|:     .|.:...||.||.:.|  |..|
Human   406 -------LLIEFFELYGRHFNYLKT-------GIRIKD-----GGSYVAKDEVQKNMLD--GYRP 449

  Fly   359 DAFQLDRAMCVQDPFELSRNVAKS 382
            .      .:.::||.:...:|.:|
Human   450 S------MLYIEDPLQPGNDVGRS 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 36/113 (32%)
TENT4BNP_001352253.1 TRF4 214..>486 CDD:227585 73/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.