DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and tent4b

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001313625.1 Gene:tent4b / 568678 ZFINID:ZDB-GENE-041021-2 Length:653 Species:Danio rerio


Alignment Length:275 Identity:69/275 - (25%)
Similarity:112/275 - (40%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KEMRGRVRVFPFGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRRSKCFADVFTIR 178
            |::.....|..|||..|||.|..|||||.:..|....||:      .....||:.| .||..:|:
Zfish   201 KDLWPNAEVCVFGSFSTGLYLPTSDIDLVVFGNWETLPLW------TLEEALRKRK-VADENSIK 258

  Fly   179 ---HASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLK--IWAKKLKL 238
               .|:||||:.....|.:.:||:.:..:.:..:..:.:...:...:..|.|.||  :..::|..
Zfish   259 VLDKATVPIIKLMDSHTEVKVDISFNVQSGVKAANLIKDYKQQYPVLPYLVLVLKQFLLQRELNE 323

  Fly   239 ISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIPARLTTLDLL 303
            :..||:.||.|..:.:..||::     .:|..|...|.:  ||                    ||
Zfish   324 VFTGGIGSYSLFLMAVSFLQLH-----CREDVSSSNPNL--GV--------------------LL 361

  Fly   304 KNFF-IYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGFPEYDEQQKLVHDAIGAPPDAFQLDRAM 367
            ..|| :|....|:.|:       |...|:     .|.:...||.||.:.|  |..|.      .:
Zfish   362 IEFFELYGRHFNYLKT-------GIRIKD-----GGSYVAKDEVQKSMLD--GYRPS------ML 406

  Fly   368 CVQDPFELSRNVAKS 382
            .::||.:...:|.:|
Zfish   407 YIEDPLQPGNDVGRS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 31/104 (30%)
tent4bNP_001313625.1 NT_PAP_TUTase 188..298 CDD:143392 31/103 (30%)
PAP_assoc 356..416 CDD:281779 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.