DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and Tailor

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster


Alignment Length:294 Identity:80/294 - (27%)
Similarity:143/294 - (48%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VRVFPFGSLVTGLALKESDIDLFLE--PNGNQPPLFHNQLYNKTSHFLR-RSKCFAD------VF 175
            :||:.|||.:||:..:.||:|||::  .:||....|.::..|.|...|| ..|.|.|      :.
  Fly   260 LRVYKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAKLRAMRKFFCDSEDWRLIN 324

  Fly   176 TIRHASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRE-LCLFLKIWAKKLKLI 239
            .|..|.||||:..|..||:..||.: |.....|:..: :.:|.::.:.: :|:::|.|.::.||.
  Fly   325 FIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNLL-KYIFESQPLTQYMCIYVKNWLERCKLT 387

  Fly   240 SHGGMTSYCLISLIIVNLQVNRLVPSVKELQ--SLCPPVILSG---VNYA---------YSLDLT 290
            ..  :::|.:..::|..||:..|:|.:..||  ......:|.|   ||:|         ..|..|
  Fly   388 EQ--ISTYSITLMVIYFLQLQALLPPIAMLQIEDAANQAVLVGPWVVNFAQKSFSELGLQQLKAT 450

  Fly   291 PPIPARLTTLDLLKNFFIYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGFPEYDEQQKLVHDAIG 355
            .|:     ....|:|||.|:...:::..::.|::|     :..:       |..:.::::|....
  Fly   451 VPV-----IKGFLRNFFAYFAKFDYEHFLVCPYIG-----QANV-------EIAKIERMLHARYS 498

  Fly   356 A-----PPDAFQLDRAMCVQDPFELSRNVAKSVS 384
            |     |..:.||.:.|.||||.:|:.||.|:|:
  Fly   499 AYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAVT 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 35/104 (34%)
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 35/105 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014320
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2580
65.840

Return to query results.
Submit another query.