DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and Trpt1

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001099801.1 Gene:Trpt1 / 293704 RGDID:1310831 Length:248 Species:Rattus norvegicus


Alignment Length:244 Identity:53/244 - (21%)
Similarity:83/244 - (34%) Gaps:98/244 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GSLVTGLALKESDIDLFLEPNG-NQPPLFHN------QLYNKTSHFLRRSKCFADVFTIR---HA 180
            |:|..||.::   .|.|:.... .|.|.||:      ||...|:...|        ||::   .:
  Rat    37 GALKLGLPMR---ADGFVPLQALLQLPQFHSFSIEDVQLVVDTNEKQR--------FTLQPGEPS 90

  Fly   181 SVPIIRCK--HQLTGLNIDI-NMSNPNSIYNSRFVGELMFRNERIRELCLFLKIWAK-KLKLISH 241
            :.|:||..  |.|....::: .:..|.::.::...|             .|.|.|.. .|..:|.
  Rat    91 TGPLIRANQGHSLQVPELELMPLETPQALPSTLVHG-------------TFWKHWPSILLNGLSR 142

  Fly   242 GGMTSYCL----------ISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIPAR 296
            .|.|...|          ||.|..|.:|               .|.::|     :|.||..||  
  Rat   143 QGRTHIHLASGLPGDSGVISGIRPNCEV---------------AVFING-----ALALTDGIP-- 185

  Fly   297 LTTLDLLKNFFIYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGF--PEY 343
                        ::|:||  ..:|:|            |...||  |:|
  Rat   186 ------------FFCSVN--GVILTP------------GNADGFLLPKY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 23/102 (23%)
Trpt1NP_001099801.1 PTS_2-RNA 26..197 CDD:280125 47/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1859
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.