DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and Tent4b

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001359262.1 Gene:Tent4b / 214627 MGIID:1917820 Length:700 Species:Mus musculus


Alignment Length:275 Identity:69/275 - (25%)
Similarity:107/275 - (38%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KEMRGRVRVFPFGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRRSKCFAD---VF 175
            ||:.....|..|||..|||.|..|||||.:.......||:      .....||:.| .||   |.
Mouse   234 KELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLW------TLEEALRKHK-VADEDSVK 291

  Fly   176 TIRHASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLK--IWAKKLKL 238
            .:..|:||||:.....|.:.:||:.:..|.:..:..:.:...:...:..|.|.||  :..:.|..
Mouse   292 VLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNE 356

  Fly   239 ISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIPARLTTLDLL 303
            :..||:.||.|..:.:..||::       ..:..|.|    ..||..                ||
Mouse   357 VFTGGIGSYSLFLMAVSFLQLH-------PREDACIP----NTNYGV----------------LL 394

  Fly   304 KNFF-IYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGFPEYDEQQKLVHDAIGAPPDAFQLDRAM 367
            ..|| :|....|:.|:       |...|:     .|.:...||.||.:.|  |..|.      .:
Mouse   395 IEFFELYGRHFNYLKT-------GIRIKD-----GGSYVAKDEVQKNMLD--GYRPS------ML 439

  Fly   368 CVQDPFELSRNVAKS 382
            .::||.:...:|.:|
Mouse   440 YIEDPLQPGNDVGRS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 32/104 (31%)
Tent4bNP_001359262.1 TRF4 201..>473 CDD:227585 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.