powered by:
Protein Alignment mkg-p and Y34F4.3
DIOPT Version :9
Sequence 1: | NP_001286981.1 |
Gene: | mkg-p / 38955 |
FlyBaseID: | FBgn0035889 |
Length: | 659 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497314.1 |
Gene: | Y34F4.3 / 189592 |
WormBaseID: | WBGene00021338 |
Length: | 121 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
Similarity: | 24/50 - (48%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 MCVQDPFELSRNVAKSVSISNLCYFRQCLVLAAQACSDQELTSQPEKLYD 416
||:.|||:...|:.:.|.:....:.|.|:..:.:..:|..:.|.....|:
Worm 62 MCIADPFKTDHNLEQGVVLQMFEFIRSCMEHSMEVFTDCRIRSDCHSRYE 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mkg-p | NP_001286981.1 |
NT_PAP_TUTase |
104..216 |
CDD:143392 |
|
Y34F4.3 | NP_497314.1 |
PAP_assoc |
25..72 |
CDD:367682 |
5/9 (56%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5260 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.