DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and Y34F4.3

DIOPT Version :10

Sequence 1:NP_648219.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_497314.1 Gene:Y34F4.3 / 189592 WormBaseID:WBGene00021338 Length:121 Species:Caenorhabditis elegans


Alignment Length:50 Identity:12/50 - (24%)
Similarity:24/50 - (48%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 MCVQDPFELSRNVAKSVSISNLCYFRQCLVLAAQACSDQELTSQPEKLYD 416
            ||:.|||:...|:.:.|.:....:.|.|:..:.:..:|..:.|.....|:
 Worm    62 MCIADPFKTDHNLEQGVVLQMFEFIRSCMEHSMEVFTDCRIRSDCHSRYE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_648219.1 NT_PAP_TUTase 104..216 CDD:143392
Y34F4.3NP_497314.1 PAP_assoc 25..72 CDD:427532 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.