DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and Y34F4.3

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_497314.1 Gene:Y34F4.3 / 189592 WormBaseID:WBGene00021338 Length:121 Species:Caenorhabditis elegans


Alignment Length:50 Identity:12/50 - (24%)
Similarity:24/50 - (48%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 MCVQDPFELSRNVAKSVSISNLCYFRQCLVLAAQACSDQELTSQPEKLYD 416
            ||:.|||:...|:.:.|.:....:.|.|:..:.:..:|..:.|.....|:
 Worm    62 MCIADPFKTDHNLEQGVVLQMFEFIRSCMEHSMEVFTDCRIRSDCHSRYE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392
Y34F4.3NP_497314.1 PAP_assoc 25..72 CDD:367682 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.