DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and T08B2.4

DIOPT Version :10

Sequence 1:NP_648219.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_491797.1 Gene:T08B2.4 / 188273 WormBaseID:WBGene00020345 Length:119 Species:Caenorhabditis elegans


Alignment Length:52 Identity:13/52 - (25%)
Similarity:25/52 - (48%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 DPFELSRNVAKSVSISNLCYFRQCLVLAAQACSDQELTS--------QPEKL 414
            ||||....:|:.|.:|...|.:.|:..:.:..:|:.:.|        ||.::
 Worm    18 DPFEADHYLAQRVDLSVYEYIQSCMEHSKKVFTDRRMRSESSPTTHLQPHRI 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_648219.1 NT_PAP_TUTase 104..216 CDD:143392
T08B2.4NP_491797.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.