DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and K05C4.4

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_001361867.1 Gene:K05C4.4 / 187019 WormBaseID:WBGene00010581 Length:437 Species:Caenorhabditis elegans


Alignment Length:345 Identity:70/345 - (20%)
Similarity:105/345 - (30%) Gaps:136/345 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LCMVCAAPFRSMQDCLAHELIKHASKPQKQLRQRL------------NAITKLFNSAQSQSERQE 73
            |.:..||.|.|:.:....:|...|....|:|..|:            ..|.|..:..:|.|.::.
 Worm   119 LKVAIAADFMSISELHTFDLTAKAKARGKELMTRVLQNVKESTIGYERNILKKASETESVSSQKS 183

  Fly    74 LR----------EALEWSESGGHLCTVLNFFACDLE-NMKTCFGHVRNCIEKEMRGRVRVFPFGS 127
            .|          ||||..:              ||| :||.||        .:.:|..||     
 Worm   184 TRNISNSVIFEFEALEMRQ--------------DLEKSMKKCF--------HDWKGVERV----- 221

  Fly   128 LVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRRSKCFADVFTIRHASVPIIRCKHQLT 192
                                         .|:||...||     |.:||           .|..:
 Worm   222 -----------------------------TYSKTDEVLR-----AQLFT-----------SHNFS 241

  Fly   193 GLNI--DINMSNPNSIYNSRFVGELMFRNERIRELCLFLKIWAKKLKLISHGGMTSYCLISLIIV 255
            ..|:  .|......:|..|..|.    :||        ||......::...|...|......::.
 Worm   242 EKNLAETILKLGFKTITESVIVD----KNE--------LKFETLASEIAEVGQYVSTVQDMSVLD 294

  Fly   256 NLQVNRLV---PSVKELQSLCPPV-ILSGVNYAYSLDLTPPIPARLTTLDLLKNFFIYYCTVNFD 316
            .:.||||:   |...::...|..: |...:|    |:......||...|:.|:||          
 Worm   295 VITVNRLLEVRPDTLDVSGFCFNLEIFRSIN----LEGIKKFTARDHCLNSLRNF---------- 345

  Fly   317 KSVLSPFLGGCVDKETTLGM 336
                 |:|..|    |.||:
 Worm   346 -----PYLPNC----TVLGL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 19/113 (17%)
K05C4.4NP_001361867.1 LRR_9 <336..433 CDD:373143 10/40 (25%)
leucine-rich repeat 351..374 CDD:275380 4/10 (40%)
leucine-rich repeat 375..398 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.