DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and F43E2.1

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_495546.2 Gene:F43E2.1 / 185708 WormBaseID:WBGene00018390 Length:467 Species:Caenorhabditis elegans


Alignment Length:255 Identity:61/255 - (23%)
Similarity:103/255 - (40%) Gaps:70/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KQLRQRLNAITKLFNSAQSQSERQELREALEWSESGGHLCTVLNFFACDLENMKTCFGHVRNCIE 113
            |||.|.:|..  ..|..||||.                           ||..|.....||..::
 Worm    28 KQLEQDINIF--YMNQRQSQSM---------------------------LEERKLYVALVRKYLK 63

  Fly   114 KE------------MRGRVRVFPFGSLVTGLALKESDIDLFL--EPNGNQPPL--------FHNQ 156
            .|            :||   :..|||..|..|.|:||:||.:  ...||:..|        |.:.
 Worm    64 SEGVTKQLASQGIKLRG---LSVFGSFPTHCASKDSDLDLCVCATATGNKKQLPVIILQAIFRDM 125

  Fly   157 LYNKTSHFLRRSKCFADVFTIRHASVPIIRCKHQLTGLNIDINMS---NPNSIYNSRFVGELMFR 218
            :|:|....:......:.:..::.|.|||||.|  :..:.:|::.:   ||.:...::::......
 Worm   126 MYSKEGQNIFGENVVSGISFVQTAKVPIIRFK--INDVPVDLSATFDDNPRTSLAAKYINAYCQL 188

  Fly   219 NERIRELCLFLKIWAKK-------LKLISHGGMTSYCLISLIIVNLQVNRLVPSVKELQS 271
            ::|.:.|.:|||.|.|.       |::..:    ||.:|.|:|..||...::|::.:..|
 Worm   189 DDRFKILVMFLKKWMKSEGRAEDHLRIYPN----SYSIILLLIHVLQWYDILPNLHQTHS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 31/136 (23%)
F43E2.1NP_495546.2 NT_PAP_TUTase 51..186 CDD:143392 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.